Home > Product > Catalog Peptides > Others > 3 x Hemagglutinin (HA) Tag

Others

warning All products are for research use only. Not for human use.

3 x Hemagglutinin (HA) Tag

[Price Inquiry]
CAT#
T02014
Sequence
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.