Home > Product > Catalog Peptides > Others > Adrenomedullin (22-52), human

Others

Adrenomedullin (22-52), human

[Price Inquiry]
CAT#
A05012
Sequence
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
M.W/Mr.
3576.1
Molecular Formula
C159H252N46O48
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.