Home > Product > Catalog Peptides > Amyloid (APP) Precursor 770 Fragments > Amyloid Precursor Protein, (APP) (721-770)

Amyloid (APP) Precursor 770 Fragments

Amyloid Precursor Protein, (APP) (721-770)

[Price Inquiry]
CAT#
A13340
Sequence
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTY
M.W/Mr.
5910.7
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.