CAT# | A13340 |
M.W/Mr. | 5910.7 |
Sequence | VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTY |
Length | 42 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A13128 | Amyloid BRI Precursor277 (89-106) | Inquiry | ||
A13101 | Amyloid Precursor-Like Protein 1, APLP1 (594-670) | Inquiry | ||
A13220 | Amyloid Precursor Protein (APP) (741-770) | Inquiry | ||
A13137 | β-Amyloid / A4 Protein Precusor (APP) (319-335) | Inquiry | ||
A13098 | Amyloid Precursor-Like Protein 2, APLP2 (706-721) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...