Home > Product > Antimicrobial Peptides > Anionic antimicrobial peptide 2, partial

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Anionic antimicrobial peptide 2, partial

[Price Inquiry]
CAT#
AF2913
Sequence
TKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
Host Chemicals
Galleria mellonella
Length
41
Activity
Antimicrobial
SwissProt ID
M4HZ11
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.