Home > Product > Catalog Peptides > Others > Apelin (23-57)-Prepro (Human)

Others

warning All products are for research use only. Not for human use.

Apelin (23-57)-Prepro (Human)

[Price Inquiry]
CAT#
A22012
Sequence
GSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQG-NH2
M.W/Mr.
3665.1
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.