Home > Product > Antimicrobial Peptides > Arasin 2

Antimicrobial Peptides

CAT#
AF2679
Sequence
SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY
Host Chemicals
Hyas araneus
Length
37
Activity
Antimicrobial
SwissProt ID
ABI74602
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.