CAT# | A13271 |
M.W/Mr. | 4328.9 |
Sequence | DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV |
Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
CAD-007 | (Des-Glu22)-Amyloid β-Protein (1-40) | Inquiry | ||
A13274 | [Lys22]-beta-Amyloid (1-40), Italian Mutation | Inquiry | ||
A13270 | [Asn7]-beta-Amyloid (1-40), Tottori-Japan Mutation | Inquiry | ||
A13262 | [Asp22] b-Amyloid (1-40) | Inquiry | ||
A13303 | [Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...