Home > Product > Catalog Peptides > Others > [Asn8, Leu18] Parathyroid Hormone (1-34), human

Others

[Asn8, Leu18] Parathyroid Hormone (1-34), human

Price Inquiry
CAT#
P03030
Sequence
SVSEIQLNHNLGKHLNSLERVEWLRKKLQDVHNF
M.W/Mr.
4082.7
Molecular Formula
C181H290N56O52
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.