Keywords Search Google Search Search

[Asn8, Leu18] Parathyroid Hormone (1-34), human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03030
M.F/Formula	C181H290N56O52
M.W/Mr.	4082.7
Sequence	SVSEIQLNHNLGKHLNSLERVEWLRKKLQDVHNF

CAT#	Product Name	Inquiry
P03002	pTH (73-84) (human)	Inquiry
P03054	Hypercalcemia Malignancy Factor (7-34), amide, human	Inquiry
P03012	Parathyroid Hormone (13-34), human	Inquiry
P03017	[Tyr34] Parathyroid Hormone (7-34), amide, bovine	Inquiry
P03014	(Tyr43)-pTH (43-68) (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of acetyl glutamyl heptapeptide-3 in skin

Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

MEN 11270, a peptide antagonist at the human B2 kinin receptor

MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...

Function of GsMTx4 in advanced atrial fibrillation

GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: