Home > Product > Catalog Peptides > Others > [Asn8, Leu18] Parathyroid Hormone (1-34), human

Others

[Asn8, Leu18] Parathyroid Hormone (1-34), human

[Price Inquiry]
CAT#
P03030
Sequence
SVSEIQLNHNLGKHLNSLERVEWLRKKLQDVHNF
M.W/Mr.
4082.7
Molecular Formula
C181H290N56O52
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.