CAT# | AF2687 |
Sequence | WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG |
Activity | Antibacterial |
Host Chemicals | Manduca sexta | Length | 37 | SwissProt ID | P14663 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2592 | Esculentin-2HSa | Inquiry | ||
AF1175 | Brevinin-1-RAA6 peptide precursor | Inquiry | ||
AF810 | Bombinin H1 | Inquiry | ||
AF1160 | Ranatuerin-2PRc precursor | Inquiry | ||
AF2511 | Ostricacin-1 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...