Home > Product > Antimicrobial Peptides > Bactericidin B-3

Antimicrobial Peptides

Bactericidin B-3

[Price Inquiry]
CAT#
AF2687
Sequence
WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG
Host Chemicals
Manduca sexta
Length
37
Activity
Antibacterial
SwissProt ID
P14663
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.