Home > Product > Catalog Peptides > Amyloid (APP) Precursor 770 Fragments > Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

Amyloid (APP) Precursor 770 Fragments

Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)

[Price Inquiry]
CAT#
A13228
Sequence
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
M.W/Mr.
3717.1
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.