Home > Product > Antimicrobial Peptides > Beta-defensin 5 , BNBD-5

Antimicrobial Peptides

Beta-defensin 5 , BNBD-5

[Price Inquiry]
CAT#
AF2826
Sequence
EVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR
Host Chemicals
Bos taurus
Length
40
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.