Home > Product > Antimicrobial Peptides > Beta-defensin 126

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 126

[Price Inquiry]
CAT#
AF3021
Sequence
NLYVKRCLNDIGICKKTCKPEEVRSEHGWVMCGKRKACCVPAD
Host Chemicals
Macaca fascicularis
Length
43
Activity
Antibacterial
SwissProt ID
Q9BEE3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.