Home > Product > Catalog Peptides > Others > BNP (64-95), rat

Others

warning All products are for research use only. Not for human use.

BNP (64-95), rat

[Price Inquiry]
CAT#
B10004
Sequence
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
M.W/Mr.
3452
Modifications
disulfide
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.