Home > Product > Catalog Peptides > Others > BNP (64-95), rat

Others

BNP (64-95), rat

Price Inquiry
CAT#
B10004
Sequence
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
M.W/Mr.
3452
Modifications
disulfide
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.