Home > Product > Antimicrobial Peptides > Brevinin-2GHc precursor

Antimicrobial Peptides

Brevinin-2GHc precursor

[Price Inquiry]
CAT#
AF2063
Sequence
SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP
Host Chemicals
Rana guentheri
Length
31
Activity
Antibacterial
SwissProt ID
A0AEI6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.