Home > Product > Antimicrobial Peptides > Brevinin-2TSa

Antimicrobial Peptides

Brevinin-2TSa

[Price Inquiry]
CAT#
AF2210
Sequence
GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC
Host Chemicals
Rana tsushimensis
Length
33
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.