Antimicrobial Peptides

CAT#
AF3315
Sequence
FSFKRLKGFAKKLWNSKLARKIRTKGLKYVKNFAKDMLSEGEEAPPAAEPPVEAPQ
Host Chemicals
venom, Isometrus maculatus
Length
56
Activity
Gram+ & Gram-, Insects,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.