Home > Product > Antimicrobial Peptides > Brevinin-2-AJ2 antimicrobial peptide precursor

Antimicrobial Peptides

Brevinin-2-AJ2 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2245
Sequence
GLMSTFKQVGISAIKGAAKNVLDVLSCKIAKTC
Host Chemicals
Amolops jingdongensis
Length
33
Activity
Antimicrobial
SwissProt ID
K7ZAL2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.