CAT# | AF2189 |
Sequence | GFMSTFKQVGISAIKGAAKNVLDVLSCKIAKTC |
Activity | Antimicrobial |
Host Chemicals | Amolops jingdongensis | Length | 33 | SwissProt ID | K7ZJ56 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF650 | Peptide 2 | Inquiry | ||
AF3221 | Pyrularia thionin | Inquiry | ||
AF146 | E12LLK | Inquiry | ||
AF2246 | Brevinin-2-AJ3 antimicrobial peptide precursor | Inquiry | ||
AF1934 | Kalata B14 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...