Home > Product > Antimicrobial Peptides > Brevinin-2-AJ4 antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Brevinin-2-AJ4 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2189
Sequence
GFMSTFKQVGISAIKGAAKNVLDVLSCKIAKTC
Host Chemicals
Amolops jingdongensis
Length
33
Activity
Antimicrobial
SwissProt ID
K7ZJ56
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.