Home > Product > Antimicrobial Peptides > Butyrivibriocin AR10

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Butyrivibriocin AR10

[Price Inquiry]
CAT#
AF3321
Sequence
IYFIADKMGIQLAPAWYQDIVNWVSAGGTLTTGFAIIVGVTVPAWIAEAAAAFGIASA
Host Chemicals
Butyrivibrium fibrisolvens AR10
Length
58
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.