Keywords Search Google Search Search

C34 - LC - Biotin, gp41 HIV fragment

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	HB00168
M.W/Mr.	4715.3
Sequence	Three-Letter Code: H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Lys (LC-BIOTIN)-NH2 One-Letter Code: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

CAT#	Product Name	Inquiry
HB00167	HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt	Inquiry
HB00161	HIV (gp120) Fragment (421-438) trifluoroacetate salt	Inquiry
HB00163	HIV (gp120) Fragment (318-327)	Inquiry
HB00164	HIV-1 gag Polyprotein (121-140)	Inquiry
HB00165	HIV (gp120) Antigenic Peptide trifluoroacetate salt	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Function of Urantide in the Rat Aorta

Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

The Function of AdTx1 for α1A-adrenoceptor

AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: