Home > Product > Antimicrobial Peptides > Cathelicidin-B1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cathelicidin-B1

[Price Inquiry]
CAT#
AF2847
Sequence
PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP
Host Chemicals
Gallus gallus
Length
40
Activity
Antibacterial
SwissProt ID
Q5F378
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.