Home > Product > Antimicrobial Peptides > Cathelin-related antimicrobial peptide

Antimicrobial Peptides

Cathelin-related antimicrobial peptide

[Price Inquiry]
CAT#
AF2240
Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Host Chemicals
Mus musculus
Length
33
Activity
Antibacterial
SwissProt ID
P51437
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.