CAT# | AF2240 |
Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE |
Activity | Antibacterial |
Host Chemicals | Mus musculus | Length | 33 | SwissProt ID | P51437 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3326 | SD2 | Inquiry | ||
AF1360 | Brevinin-1-OR5 | Inquiry | ||
AF1165 | Human LL-23 | Inquiry | ||
AF3166 | Defensin Tk-AMP-D4 | Inquiry | ||
AF1369 | Grammistin Pp4a | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...