Home > Product > Antimicrobial Peptides > CECA1_DROSI Cecropin-A1 precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

CECA1_DROSI Cecropin-A1 precursor

[Price Inquiry]
CAT#
AF3027
Sequence
QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR
Host Chemicals
Drosophila simulans
Length
43
Activity
Antibacterial
SwissProt ID
O61272
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.