Keywords Search Google Search Search

Cecropin-P2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1982
Sequence	WLSKTYKKLENSAKKRISEGIAIAIQGGPR
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF2240	Cathelin-related antimicrobial peptide	Inquiry
AF2408	Defensin-B	Inquiry
AF1462	Dermadistinctin-Q2	Inquiry
AF254	Uperin-7.1	Inquiry
AF2206	Brevinin-2E	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

Thyrotropin releasing hormone-protirelin

Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...

Function of acetyl glutamyl heptapeptide-3 in skin

Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...

Function of corticotropin in the diagnosis of adrenocortical function

Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...

Brief information of insulin

Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Ascaris suum
Length	30
SwissProt ID	Q5H7N6