Home > Product > Antimicrobial Peptides > Chicken AvBD1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Chicken AvBD1

[Price Inquiry]
CAT#
AF2715
Sequence
GRKSDCFRKSGFCAFLKPSLTLISGKCSRFYLCCKRIW
Host Chemicals
Gallus gallus
Length
38
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.