Home > Product > Antimicrobial Peptides > Dermatoxin-J2

Antimicrobial Peptides

Dermatoxin-J2

[Price Inquiry]
CAT#
AF2149
Sequence
SLGGFLKGVGKALAGVGKMVADQFGNLLQAGQ
Host Chemicals
Phasmahyla jandaia
Length
32
Activity
Antimicrobial
SwissProt ID
P86622
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.