Home > Product > Antimicrobial Peptides > Chicken AvBD12

Antimicrobial Peptides

Chicken AvBD12

[Price Inquiry]
CAT#
AF3150
Sequence
GPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
Host Chemicals
Gallus gallus
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.