Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3288
Sequence
RHRHCFSQSHKFVGACLRESNCENVCKTEGFPSGECKWHGIVSKCHCKRIC
Host Chemicals
Sugarcane, Saccharum officinarum
Length
51
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.