Home > Product > Antimicrobial Peptides > Corticostatin-related peptide RK-1

Antimicrobial Peptides

Corticostatin-related peptide RK-1

[Price Inquiry]
CAT#
AF2140
Sequence
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK
Host Chemicals
Oryctolagus cuniculus
Length
32
Activity
Antibacterial
SwissProt ID
P81655
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.