Corticotropin

Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-167
CAS	9002-60-2,12427-33-7
Synonyms/Alias	Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel
M.F/Formula	C207H308N56O58S
M.W/Mr.	4541.06582
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Labeling Target	Adrenocorticotropic hormone receptor
Application	Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
Activity	Agonist
Biological Activity	Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency.
Areas of Interest	Neurological Disease
Functions	Melanocortin receptor activity
Disease	West syndrome Stevens-Johnson syndrome Exacerbation of multiple sclerosis

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-154	PMX 205	839.05	C45H62N10O6	Inquiry
10-101-180	Solanezumab	144000.1g/mol	C6396H9922N1712O1996S42	Inquiry
10-101-91	Neuropeptide Y (human, rat) Acetate	4271.74	C189H285N55O57S	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Storage	-20°C
Organism	Human