CRF(human,rat)

Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-294
CAS	86784-80-7
Synonyms/Alias	Corticotropin-releasing factor (human); Human CRF; Human corticotropin-releasing factor
M.F/Formula	C208H344N60O63S2
M.W/Mr.	4758
Sequence	One Letter Code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide) Three Letter Code: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Purity	> 98%

CAT#	Product Name	Inquiry
10-101-65	Obestatin (human)	Inquiry
10-101-236	Fmoc-AEEA	Inquiry
10-101-174	Difelikefalin acetate	Inquiry
HB00104	DALARGIN	Inquiry
10-101-54	Teriparatide Acetate	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Solubility	Soluble to 1.10 mg/ml in water
Shipping Condition	Wet ice in continental US; may vary elsewhere
InChI Key	VXFVFWFSJFSXHN-FAUHKOHMSA-N