Home > Product > Antimicrobial Peptides > Cyclotide vibi-E

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cyclotide vibi-E

[Price Inquiry]
CAT#
AF1904
Sequence
GIPCAESCVWIPCTVTALIGCGCSNKVCYN
Host Chemicals
Viola biflora
Length
30
Activity
Antimicrobial, Anticancer
SwissProt ID
B1NRQ8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.