Home > Product > Antimicrobial Peptides > Cycloviolacin O8

Antimicrobial Peptides

Cycloviolacin O8

[Price Inquiry]
CAT#
AF1944
Sequence
GTLPCESCVWIPCISSVVGCSCKSKVCYKN
Host Chemicals
Viola odorata
Length
30
Activity
Parasites,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.