Home > Product > Antimicrobial Peptides > Def-Bat

Antimicrobial Peptides

CAT#
AF2389
Sequence
SQWVTPNDSLCAAHCIARRYRGGYCNGKRVCVCR
Host Chemicals
Anopheles gambiae
Length
34
Activity
Antibacterial
SwissProt ID
Q17027
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.