Home > Product > Antimicrobial Peptides > Defensin 3

Antimicrobial Peptides

Defensin 3

[Price Inquiry]
CAT#
AF2313
Sequence
SQWVTPNHAACAAHCLLRGNRGGECKGTICHCR
Host Chemicals
Triatoma brasiliensis
Length
33
Activity
Antibacterial
SwissProt ID
C6ZEC4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.