Home > Product > Antimicrobial Peptides > Defensin-NV

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin-NV

[Price Inquiry]
CAT#
AF3297
Sequence
VTCELLMFGGVVGDSACAANCLSMGKAGGSCNGGLCDCRKTTFKELWDKRFG
Host Chemicals
the ectoparasitic wasp, Nasonia vitripennis
Length
52
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.