Home > Product > Antimicrobial Peptides > Defr1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2343
Sequence
DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK
Host Chemicals
Mus musculus
Length
34
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.