Home > Product > Antimicrobial Peptides > Defr1

Antimicrobial Peptides

CAT#
AF2343
Sequence
DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK
Host Chemicals
Mus musculus
Length
34
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.