Home > Product > Antimicrobial Peptides > Dermaseptin-L1

Antimicrobial Peptides

Dermaseptin-L1

Price Inquiry
CAT#
AF2104
Sequence
GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS
Host Chemicals
Hylomantis lemur
Length
32
Activity
Antibacterial, Antifungal

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.