Home > Product > Antimicrobial Peptides > Dermaseptin-L1

Antimicrobial Peptides

Dermaseptin-L1

[Price Inquiry]
CAT#
AF2104
Sequence
GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS
Host Chemicals
Hylomantis lemur
Length
32
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.