Home > Product > Antimicrobial Peptides > Dermaseptin PD-2-2

Antimicrobial Peptides

Dermaseptin PD-2-2

[Price Inquiry]
CAT#
AF1987
Sequence
ALWKTLLKKVGKVAGKAVLNAVTNMANQNEQ
Host Chemicals
Pachymedusa dacnicolor
Length
31
Activity
Antibacterial
SwissProt ID
O93452
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.