Home > Product > Antimicrobial Peptides > Enteric beta-defensin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Enteric beta-defensin

[Price Inquiry]
CAT#
AF2741
Sequence
NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR
Host Chemicals
Bos taurus
Length
38
Activity
Antibacterial
SwissProt ID
O02775
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.