Home > Product > Antimicrobial Peptides > ENAP-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3079
Sequence
DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF
Host Chemicals
Equus caballus
Length
44
Activity
Antibacterial
SwissProt ID
P80930
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.