Home > Product > Antimicrobial Peptides > Enterocin A

Antimicrobial Peptides

Enterocin A

[Price Inquiry]
CAT#
AF2476
Sequence
YYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGG
Host Chemicals
Synthetic construct
Length
35
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.