Home > Product > Antimicrobial Peptides > Enterocin 1071

Antimicrobial Peptides

Enterocin 1071

[Price Inquiry]
CAT#
AF2765
Sequence
ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
Host Chemicals
Enterococcus faecalis BFE 1071
Length
39
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.