Home > Product > Antimicrobial Peptides > Esculentin-1PLa

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-1PLa

[Price Inquiry]
CAT#
AF3191
Sequence
GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC
Host Chemicals
pickerel frog, Rana palustris, North America
Length
46
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.