Home > Product > Antimicrobial Peptides > Esculentin-2N protein precursor, partial

Antimicrobial Peptides

Esculentin-2N protein precursor, partial

[Price Inquiry]
CAT#
AF2503
Sequence
IFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQC
Host Chemicals
Pelophylax nigromaculatus
Length
36
Activity
Antimicrobial
SwissProt ID
G3E7R8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.