Home > Product > Antimicrobial Peptides > Esculentin-2S

Antimicrobial Peptides

Esculentin-2S

[Price Inquiry]
CAT#
AF2622
Sequence
GLFTLIKGAVKMIGKTVAKEAGKTGLELMACKVTNQC
Host Chemicals
Odorrana schmackeri
Length
37
Activity
Antibacterial
SwissProt ID
Q1MU20
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.