Home > Product > Antimicrobial Peptides > Esculentin-2V protein

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2V protein

[Price Inquiry]
CAT#
AF2598
Sequence
GIFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC
Host Chemicals
Odorrana versabilis
Length
37
Activity
Antimicrobial
SwissProt ID
Q1MU18
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.