Home > Product > Antimicrobial Peptides > Beta-defensin 38

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 38

[Price Inquiry]
CAT#
AF2943
Sequence
IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY
Host Chemicals
Mus musculus
Length
42
Activity
Antibacterial
SwissProt ID
Q7TNV7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.