Home > Product > Antimicrobial Peptides > Esculentin-2-OG5 antimicrobial peptide

Antimicrobial Peptides

Esculentin-2-OG5 antimicrobial peptide

[Price Inquiry]
CAT#
AF2621
Sequence
GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC
Host Chemicals
Rana grahami
Length
37
Activity
Antimicrobial
SwissProt ID
A6MAX6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.