Home > Product > Antimicrobial Peptides > Esculentin-2-OR2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Esculentin-2-OR2

[Price Inquiry]
CAT#
AF2636
Sequence
GVFTLIKGATQLIGKTLGKEVGKTGLELMACKITKQC
Host Chemicals
Odorrana rotodora
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.